You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1977116 |
---|---|
Category | Proteins |
Description | Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B. Functions also as a transcriptional coactivator, stimulating transcription mediated by the transcription factor CRX and NR2E3. Binds in a sequence-specific manner to the rhodopsin promoter. NRL Protein, Mouse, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 46.1 kDa and the accession number is P54846. |
Tag | N-10xHis-SUMO, C-Myc |
Purity | 98.00% |
MW | 46.1 kDa (predicted) |
UniProt ID | P54846 |
Protein Sequence | MAFPPSPLAMEYVNDFDLMKFEIKREPSEGRSGVPTASLGSTPYSSVPPSPTFSEPGMVGGGEAPRPGLEELYWLATLQQQLGSDEVLGLSPDEAVELLQNQGPVSMEGPLGYYSGSPGETGAQHVQLPERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSGGPGSDDHTHLFL |
Expression System | E. coli |
Biological Origin | Mouse |
Biological Activity | Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B. Functions also as a transcriptional coactivator, stimulating transcription mediated by the transcription factor CRX and NR2E3. Binds in a sequence-specific manner to the rhodopsin promoter. NRL Protein, Mouse, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 46.1 kDa and the accession number is P54846. |
Expression Region | 1-237 aa |
Storage | -20°C |
Note | For research use only |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expiration Date | 6 months from date of receipt. |