NRG2 monoclonal antibody (M01), clone 3D2

• Catalog Number: orb2291701
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant NRG2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: NRG2 (NP_004874, 116 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: SLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLD
• Tested applications: ELISA, WB
• Clone Number: 3D2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_004874

Detection limit for recombinant GST tagged NRG2 is approximately 0.03 ng/ml as a capture antibody.

NRG2 monoclonal antibody (M01), clone 3D2. Western Blot analysis of NRG2 expression in human pancreas.

Western Blot detection against Immunogen (36.74 KDa).