NR4A3 monoclonal antibody (M02), clone 1E9

• Catalog Number: orb2291921
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant NR4A3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1E9
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: NR4A3 (NP_008912, 414 a.a. ~ 521 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: LDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFS
• NCBI: NP_008912
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged NR4A3 is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to NR4A3 on HeLa cell. [antibody concentration 10 ug/ml]

NR4A3 monoclonal antibody (M02), clone 1E9 Western Blot analysis of NR4A3 expression in Hela S3 NE.

Western Blot detection against Immunogen (37.62 KDa).