NR1H4 monoclonal antibody (M02), clone 1B10

• Catalog Number: orb2291647
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant NR1H4.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B10
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: NR1H4 (NP_005114, 363 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ
• NCBI: NP_005114
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged NR1H4 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to NR1H4 on HeLa cell. [antibody concentration 10 ug/ml]

NR1H4 monoclonal antibody (M02), clone 1B10 Western Blot analysis of NR1H4 expression in HepG2.

Western Blot detection against Immunogen (37.84 KDa).