NQO1 Antibody

• Catalog Number: orb308792
• Category: Antibodies
• Description: NQO1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human NQO1 (242-274aa EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK), different from the related mouse and rat sequences by five amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Rat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 30868 MW
• UniProt ID: P15559
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: NAD (P)H dehydrogenase [quinone] 1;1.6.5.2;Azoredu
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of NQO1 using anti-NQO1 antibody.Lane 1:Rat Liver Tissue;2:Rat Lung Tissue;3:HELA Cell;4:A549 Cell;5:MM231 Cell;6:SW620 Cell;7:22RV1 Cell.