You have no items in your shopping cart.
Cart summary
NPY2R Protein, Mouse, Recombinant (His)
Catalog Number: orb1977111
| Catalog Number | orb1977111 |
|---|---|
| Category | Proteins |
| Description | Receptor for neuropeptide Y and peptide YY. NPY2R Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 11.0 kDa and the accession number is P97295. |
| Tag | N-10xHis |
| Purity | 98.00% |
| MW | 11.0 kDa (predicted) |
| UniProt ID | P97295 |
| Protein Sequence | MGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTKLVEVQV |
| Expression System | E. coli |
| Biological Origin | Mouse |
| Biological Activity | Receptor for neuropeptide Y and peptide YY. NPY2R Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 11.0 kDa and the accession number is P97295. |
| Expression Region | 1-51 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
