Cart summary

You have no items in your shopping cart.

    NPCL1 antibody

    Catalog Number: orb327371

    DispatchUsually dispatched within 1 - 2 weeks
    $ 609.00
    Catalog Numberorb327371
    CategoryAntibodies
    DescriptionRabbit polyclonal antibody to NPCL1
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    Predicted ReactivityHuman
    ReactivityHuman
    ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human NPCL1
    Concentration0.5 mg/ml
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    ConjugationUnconjugated
    MW149kDa
    TargetNPC1L1
    UniProt IDQ9UHC9
    Protein SequenceSynthetic peptide located within the following region: YGSALCNAQRWLNFQGDTGNGLAPLDITFHLLEPGQAVGSGIQPLNEGVA
    StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Alternative namesanti NPC1L1 antibody, anti antibody
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    NPCL1 antibody

    Western blot analysis of human Fetal Liver tissue using NPCL1 antibody

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars