NPAS2 monoclonal antibody (M03), clone 6C9

• Catalog Number: orb2292497
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant NPAS2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6C9
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: NPAS2 (NP_002509, 646 a.a. ~ 738 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: NLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLH
• NCBI: NP_002509
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of NPAS2 expression in transfected 293T cell line by NPAS2 monoclonal antibody (M03), clone 6C9. Lane 1: NPAS2 transfected lysate (91.8 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.97 KDa).