You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292497 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant NPAS2. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 6C9 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | NPAS2 (NP_002509, 646 a.a. ~ 738 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | NLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLH |
NCBI | NP_002509 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western Blot analysis of NPAS2 expression in transfected 293T cell line by NPAS2 monoclonal antibody (M03), clone 6C9. Lane 1: NPAS2 transfected lysate (91.8 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (35.97 KDa).