You have no items in your shopping cart.
Cart summary
NOX4 Recombinant Protein (Rat)
Catalog Number: orb2050654
| Catalog Number | orb2050654 |
|---|---|
| Category | Proteins |
| Description | NOX4 Recombinant Protein (Rat) |
| Tag | N-terminal 6xHis-B2M-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 38.6 kDa |
| UniProt ID | Q924V1 |
| Protein Sequence | GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE |
| Source | E.coli |
| NCBI | NP_445976 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | kidney oxidase-1;kidney superoxide-producing NADPH Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Rat Nox4 protein [orb245944]
Greater than 90% as determined by SDS-PAGE.
40.6 kDa
Yeast
20 μg, 100 μg, 500 μg, 1 mgRat NOX4 protein [orb418913]
Greater than 90% as determined by SDS-PAGE.
38.6 kDa
E.coli
20 μg, 100 μg, 1 mgNOX4 Recombinant Protein (Rat) [orb2050652]
Greater than 90% as determined by SDS-PAGE.
38.6 kDa
E.coli
20 μgNOX4 Recombinant Protein (Rat) [orb2050653]
Greater than 90% as determined by SDS-PAGE.
38.6 kDa
E.coli
1 mgNOX4 Recombinant Protein (Rat) [orb2053560]
Greater than 90% as determined by SDS-PAGE.
40.6 kDa
Yeast
500 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
