NME2 monoclonal antibody (M08), clone 1F2

• Catalog Number: orb2292510
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant NME2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1F2
• Tested applications: ELISA, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG3 Kappa
• Immunogen: NME2 (NP_002503, 51 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
• NCBI: NP_002503
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunofluorescence of monoclonal antibody to NME2 on HeLa cell. [antibody concentration 10 ug/ml]

NME2 monoclonal antibody (M08), clone 1F2 Western Blot analysis of NME2 expression in HeLa.

NME2 monoclonal antibody (M08), clone 1F2. Western Blot analysis of NME2 expression in NIH/3T3.

NME2 monoclonal antibody (M08), clone 1F2. Western Blot analysis of NME2 expression in PC-12.

NME2 monoclonal antibody (M08), clone 1F2. Western Blot analysis of NME2 expression in Raw 264.7.

Western Blot detection against Immunogen (36.96 KDa).