NME1 monoclonal antibody (M02), clone 1D7

• Catalog Number: orb2292512
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant NME1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1D7
• Tested applications: ELISA, IF, IHC-P, IP, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: NME1 (NP_000260, 43 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: ASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
• NCBI: NP_000260
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged NME1 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to NME1 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to NME1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

Immunoprecipitation of NME1 transfected lysate using anti-NME1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NME1 MaxPab rabbit polyclonal antibody.

NME1 monoclonal antibody (M02), clone 1D7. Western Blot analysis of NME1 expression in different cell lines.

NME1 monoclonal antibody (M02), clone 1D7. Western Blot analysis of NME1 expression in HeLa.

Western Blot analysis of NME1 expression in transfected 293T cell line by NME1 monoclonal antibody (M02), clone 1D7. Lane 1: NME1 transfected lysate (19.7 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).