Bapx1 Rabbit Polyclonal Antibody

• Catalog Number: orb576112
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Bapx1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse Bapx1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 37kDa
• Target: Nkx3-2
• UniProt ID: P97503
• Protein Sequence: Synthetic peptide located within the following region: MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVC
• NCBI: NP_031550
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Bap, Bapx1, NKX3.2, Nkx-3., Nkx-3.2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 0.5 ug/ml, Peptide Concentration: 1.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

WB Suggested Anti-Bapx1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.