NKX2-5 monoclonal antibody (M01), clone 1E4-G5

• Catalog Number: orb2293982
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant NKX2-5.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: NKX2-5 (AAH25711, 1 a.a. ~ 324 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW
• Tested applications: ELISA, WB
• Clone Number: 1E4-G5
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH25711

Detection limit for recombinant GST tagged NKX2-5 is approximately 0.03 ng/ml as a capture antibody.

NKX2-5 monoclonal antibody (M01), clone 1E4-G5 Western Blot analysis of NKX2-5 expression in HeLa.

NKX2-5 monoclonal antibody (M01), clone 1E4-G5. Western Blot analysis of NKX2-5 expression in human thyroid (diffuse hyperplasia).

Western Blot analysis of NKX2-5 expression in transfected 293T cell line by NKX2-5 monoclonal antibody (M01), clone 1E4-G5. Lane 1: NKX2-5 transfected lysate (34.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (61.38 KDa).