You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293979 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant NKX2-5. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | NKX2-5 (NP_004378, 1 a.a. ~ 130 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNA* |
Tested applications | ELISA, IF, IP, WB |
Clone Number | 3C1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_004378 |
Immunofluorescence of monoclonal antibody to NKX2-5 on HeLa cell. [antibody concentration 15 ug/ml]
Immunoprecipitation of NKX2-5 transfected lysate using anti-NKX2-5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NKX2-5 MaxPab rabbit polyclonal antibody.
Western Blot analysis of NKX2-5 expression in transfected 293T cell line by NKX2-5 monoclonal antibody (M04), clone 3C1. Lane 1: NKX2-5 transfected lysate (34.9 KDa). Lane 2: Non-transfected lysate.