NKX2-5 monoclonal antibody (M05), clone 4B11

• Catalog Number: orb2293978
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant NKX2-5.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2b Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: NKX2-5 (NP_004378, 1 a.a. ~ 130 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNA*
• Tested applications: ELISA, IP, WB
• Clone Number: 4B11
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_004378

Immunoprecipitation of NKX2-5 transfected lysate using anti-NKX2-5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NKX2-5 MaxPab rabbit polyclonal antibody.

Western Blot analysis of NKX2-5 expression in transfected 293T cell line by NKX2-5 monoclonal antibody (M05), clone 4B11. Lane 1: NKX2-5 transfected lysate (34.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (40.41 KDa).