Niemann Pick C2/NPC2 Antibody

• Catalog Number: orb412971
• Category: Antibodies
• Description: Niemann Pick C2/NPC2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human Niemann Pick C2 (KSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVS).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot,0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section),0.5-1μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 16 kDa
• UniProt ID: P61916
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Epididymal secretory protein E1; Human epididymis-
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Niemann Pick C2 using anti-Niemann Pick C2 antibody.Lane 1:human SK-OV-3 cell.

IHC analysis of Niemann Pick C2 using anti-Niemann Pick C2 antibody.Niemann Pick C2 was detected in paraffin-embedded section of human lung cancer tissue.

IHC analysis of Niemann Pick C2 using anti-Niemann Pick C2 antibody.Niemann Pick C2 was detected in paraffin-embedded section of human intestinal cancer tissue.