Nicotinic Acetylcholine Receptor alpha 3/CHRNA3 Antibody

• Catalog Number: orb412978
• Category: Antibodies
• Description: Nicotinic Acetylcholine Receptor alpha 3/CHRNA3 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human CHRNA3 (DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot,0.1-0.5μg/ml Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 60 kDa
• UniProt ID: P32297
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Neuronal acetylcholine receptor subunit alpha-3; C
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of U251 cells using anti-CHRNA3 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of U-87 cells using anti-CHRNA3 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of CHRNA3 using anti-CHRNA3 antibody.Lane 1:human HeLa cell;2:human MDA-MB-453 cell;3:human Jurkat cell;4:human HepG2 cell;5:human SK-OV-3 cell;6:human PANC-1 cell;7:mouse thymus tissue.