You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb527055 |
---|---|
Category | Antibodies |
Description | NFIA Antibody (monoclonal, 16H11) |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 16H11 |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Human |
Isotype | Mouse IgG2b |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 2μg/ml Flow Cytometry, 1-3μg/1x106 cells |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 62 kDa |
UniProt ID | Q12857 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Nuclear factor 1 A-type; NF1-A; Nuclear factor 1/A Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500μg/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U20S cells using anti-NFIA antibody (Blue line).Isotype control antibody (Green line) was mouse IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of NFIA using anti-NFIA antibody.Lane 1:human HeLa cell;2:human HEK293 cell.
IF analysis of NFIA using anti-NFIA antibody. NFIA was detected in immunocytochemical section of A431 cells.
IHC analysis of NFIA using anti-NFIA antibody. NFIA was detected in paraffin-embedded section of human intestinal cancer tissue.
IHC analysis of NFIA using anti-NFIA antibody. NFIA was detected in paraffin-embedded section of human intestinal cancer tissue.
IHC analysis of NFIA using anti-NFIA antibody. NFIA was detected in paraffin-embedded section of human tonsil tissue.
Filter by Rating