NFIA Antibody (monoclonal, 16H11)

• Catalog Number: orb527055
• Category: Antibodies
• Description: NFIA Antibody (monoclonal, 16H11)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 16H11
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human
• Isotype: Mouse IgG2b
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 2μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 62 kDa
• UniProt ID: Q12857
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Nuclear factor 1 A-type; NF1-A; Nuclear factor 1/A
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500μg/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of U20S cells using anti-NFIA antibody (Blue line).Isotype control antibody (Green line) was mouse IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of NFIA using anti-NFIA antibody.Lane 1:human HeLa cell;2:human HEK293 cell.

IF analysis of NFIA using anti-NFIA antibody. NFIA was detected in immunocytochemical section of A431 cells.

IHC analysis of NFIA using anti-NFIA antibody. NFIA was detected in paraffin-embedded section of human intestinal cancer tissue.

IHC analysis of NFIA using anti-NFIA antibody. NFIA was detected in paraffin-embedded section of human intestinal cancer tissue.

IHC analysis of NFIA using anti-NFIA antibody. NFIA was detected in paraffin-embedded section of human tonsil tissue.