NF-kappaB p100/p52 Antibody (Phospho-Ser865)

• Catalog Number: orb2240474
• Category: Antibodies
• Description: NF-kappaB p100/p52 Antibody (Phospho-Ser865)
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, ICC, IF, IHC-P, IP, WB
• Isotype: IgG
• Immunogen: The antiserum was produced against synthesized peptide derived from human NF-kappaB p100/p52 around the phosphorylation site of Ser865.
• Form/Appearance: Liquid PBS containing 50% glycerol, 0.5% rAlbumin and 0.02% sodium azide.
• Conjugation: Unconjugated
• MW: 96 kDa
• UniProt ID: Q00653
• Protein Sequence: Synthetic peptide located within the following region: EALSDMGLEEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGP
• Storage: -20°C
• Buffer/Preservatives: Liquid PBS containing 50% glycerol, 0.5% rAlbumin and 0.02% sodium azide.
• Alternative names: CVID10;DNA-binding factor KBF2;H2TF1;lymphocyte tr
• Note: For research use only
• Application notes: Application Info: WB: 1/500 - 1/2000IHC: 1/100 - 1/300IP: 2-5 ug/mg lysate.IF: 1/200 - 1/1000ELISA: 1/20000
• Expiration Date: 12 months from date of receipt.