NEU2 monoclonal antibody (M03), clone 3B9

• Catalog Number: orb2292521
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant NEU2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3B9
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: NEU2 (NP_005374, 180 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP
• NCBI: NP_005374
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

NEU2 monoclonal antibody (M03), clone 3B9. Western Blot analysis of NEU2 expression in human fetal liver.

NEU2 monoclonal antibody (M03), clone 3B9. Western Blot analysis of NEU2 expression in human liver.

Western Blot detection against Immunogen (35.53 KDa).