NEK9 monoclonal antibody (M01), clone 1F6

• Catalog Number: orb2290718
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant NEK9.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1F6
• Tested applications: ELISA, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2a Kappa
• Immunogen: NEK9 (AAH09336, 226 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: AGKGTPLTPPACACSSLQVEVERLQGLVLKCLAEQQKLQQENLQIFTQLQKLNKKLEGGQQVGMHSKGTQTAKEEMEMDPKPDLDSDSWCLLGTDSCRPSL
• NCBI: AAH09336
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged NEK9 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to NEK9 on HeLa cell. [antibody concentration 10 ug/ml]

NEK9 monoclonal antibody (M01), clone 1F6 Western Blot analysis of NEK9 expression in HeLa.

NEK9 monoclonal antibody (M01), clone 1F6. Western Blot analysis of NEK9 expression in NIH/3T3.

NEK9 monoclonal antibody (M01), clone 1F6. Western Blot analysis of NEK9 expression in PC-12.

NEK9 monoclonal antibody (M01), clone 1F6. Western Blot analysis of NEK9 expression in Raw 264.7.

Western Blot analysis of NEK9 expression in transfected 293T cell line by NEK9 monoclonal antibody (M01), clone 1F6. Lane 1: NEK9 transfected lysate(107.2 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).