NEDD9 monoclonal antibody (M01), clone 1B4

• Catalog Number: orb2292525
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant NEDD9.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B4
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: NEDD9 (NP_006394, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: PRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPV
• NCBI: NP_006394
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunofluorescence of monoclonal antibody to NEDD9 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of NEDD9 expression in transfected 293T cell line by NEDD9 monoclonal antibody (M01), clone 1B4. Lane 1: NEDD9 transfected lysate (92.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).