NDUFV1 monoclonal antibody (M01), clone 4A7

• Catalog Number: orb2292528
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant NDUFV1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4A7
• Tested applications: ELISA, WB
• Reactivity: Human, Rat
• Isotype: IgG2b Kappa
• Immunogen: NDUFV1 (NP_002466, 365 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: KAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS
• NCBI: NP_002466
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged NDUFV1 is approximately 1 ng/ml as a capture antibody.

NDUFV1 monoclonal antibody (M01), clone 4A7. Western Blot analysis of NDUFV1 expression in PC-12.

Western Blot analysis of NDUFV1 expression in transfected 293T cell line by NDUFV1 monoclonal antibody (M01), clone 4A7. Lane 1: NDUFV1 transfected lysate (50.8 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of NDUFV1 over-expressed 293 cell line, cotransfected with NDUFV1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with NDUFV1 monoclonal antibody (M01), clone 4A7 (Cat # orb2292528). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.74 KDa).