NDUFS3 monoclonal antibody (M02), clone 1D6

• Catalog Number: orb2292529
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant NDUFS3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1D6
• Tested applications: ELISA, IHC-P, IP, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: NDUFS3 (AAH00617, 1 a.a. ~ 264 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK
• NCBI: AAH00617
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoperoxidase of monoclonal antibody to NDUFS3 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]

Immunoprecipitation of NDUFS3 transfected lysate using anti-NDUFS3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NDUFS3 MaxPab rabbit polyclonal antibody.

Western Blot analysis of NDUFS3 expression in transfected 293T cell line by NDUFS3 monoclonal antibody (M02), clone 1D6. Lane 1: NDUFS3 transfected lysate (30.2 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of NDUFS3 over-expressed 293 cell line, cotransfected with NDUFS3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with NDUFS3 monoclonal antibody (M02), clone 1D6 (Cat # orb2292529). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (54.56 KDa).