You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292532 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant NDN. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1B3 |
Tested applications | ELISA, IF, IHC-P, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | NDN (NP_002478, 222 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | WKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED |
NCBI | NP_002478 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged NDN is approximately 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to NDN on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to NDN on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml]
NDN monoclonal antibody (M02), clone 1B3 Western Blot analysis of NDN expression in HL-60.
Western Blot analysis of NDN expression in transfected 293T cell line by NDN monoclonal antibody (M02), clone 1B3. Lane 1: NDN transfected lysate (36.1 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of NDN over-expressed 293 cell line, cotransfected with NDN Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with NDN monoclonal antibody (M02), clone 1B3 (Cat # orb2292532). GAPDH (36.1 kDa) used as specificity and loading control.
Western Blot detection against Immunogen (37.11 KDa).