NDN monoclonal antibody (M02), clone 1B3

• Catalog Number: orb2292532
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant NDN.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B3
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: NDN (NP_002478, 222 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: WKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED
• NCBI: NP_002478
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged NDN is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to NDN on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to NDN on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml]

NDN monoclonal antibody (M02), clone 1B3 Western Blot analysis of NDN expression in HL-60.

Western Blot analysis of NDN expression in transfected 293T cell line by NDN monoclonal antibody (M02), clone 1B3. Lane 1: NDN transfected lysate (36.1 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of NDN over-expressed 293 cell line, cotransfected with NDN Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with NDN monoclonal antibody (M02), clone 1B3 (Cat # orb2292532). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (37.11 KDa).