You have no items in your shopping cart.
Cart summary
NDK1 Protein, Arabidopsis thaliana, Recombinant (His & Myc)
Catalog Number: orb1979811
| Catalog Number | orb1979811 |
|---|---|
| Category | Proteins |
| Description | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Plays a role in response to reactive oxygen species (ROS) stress. NDK1 Protein, Arabidopsis thaliana, Recombinant (His & Myc) is expressed in yeast with N-10xHis and C-Myc tag. The predicted molecular weight is 20.5 kDa and the accession number is P39207. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| MW | 20.5 kDa (predicted) |
| UniProt ID | P39207 |
| Protein Sequence | MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYET |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Arabidopsis thaliana |
| Biological Activity | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Plays a role in response to reactive oxygen species (ROS) stress. NDK1 Protein, Arabidopsis thaliana, Recombinant (His & Myc) is expressed in yeast with N-10xHis and C-Myc tag. The predicted molecular weight is 20.5 kDa and the accession number is P39207. |
| Expression Region | 1-149 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
