You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb623874 |
---|---|
Category | Antibodies |
Description | ND4/Mtnd4 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of rat ND4/Mtnd4 (ANKKIWTNVTSYSFLVSLLSLSLLWQNDEN). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.25-0.5μg/ml, Rat |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 48 kDa |
UniProt ID | P05508 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | NADH-ubiquinone oxidoreductase chain 4; NADH dehyd Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of Mtnd4 using anti-Mtnd4 antibody (orb623874). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat spleen tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Mtnd4 antigen affinity purified polyclonal antibody (Catalog # orb623874) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # orb90503) with Tanon 5200 system. A specific band was detected for Mtnd4 at approximately 48KD. The expected band size for Mtnd4 is at 52KD.
Filter by Rating