NCAM / CD56 Antibody (aa759-858)

• Catalog Number: orb1536613
• Category: Antibodies
• Description: NCAM / CD56 Antibody (aa759-858)
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IHC-P, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 759-858 of human NCAM1 (NP_851996.2). LCGKAGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAEVKTVPNDATQTKENESKA
• Dilution range: IHC, IHC-P (1:200), WB (1:500 - 1:2000)
• Conjugation: Unconjugated
• Target: NCAM / CD56
• Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Buffer/Preservatives: PBS, 50% glycerol, pH 7.3. PBS, 50% glycerol, pH 7.3
• Alternative names: NCAM1, CD56, CD56 antigen, MSK39, NCAM-1, N-CAM-1,
• Note: For research use only
• Application notes: Further information: The predicted MW is 40kDa/73kDa/80kDa/83kDa/93kDa/94kDa, while the observed MW by Western blot was 140kDa.
• Expiration Date: 12 months from date of receipt.