You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292629 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant NBR1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | NBR1 (NP_005890, 2 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV |
Tested applications | ELISA, WB |
Clone Number | 5C3 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_005890 |
Detection limit for recombinant GST tagged NBR1 is approximately 0.03 ng/ml as a capture antibody.
Western Blot analysis of NBR1 expression in transfected 293T cell line by NBR1 monoclonal antibody (M05), clone 5C3. Lane 1: NBR1 transfected lysate (107.4 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of NBR1 over-expressed 293 cell line, cotransfected with NBR1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with NBR1 monoclonal antibody (M05), clone 5C3 (Cat # orb2292629). GAPDH (36.1 kDa) used as specificity and loading control.
Western Blot detection against Immunogen (36.19 KDa).