NBR1 monoclonal antibody (M05), clone 5C3

• Catalog Number: orb2292629
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant NBR1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: NBR1 (NP_005890, 2 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV
• Tested applications: ELISA, WB
• Clone Number: 5C3
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_005890

Detection limit for recombinant GST tagged NBR1 is approximately 0.03 ng/ml as a capture antibody.

Western Blot analysis of NBR1 expression in transfected 293T cell line by NBR1 monoclonal antibody (M05), clone 5C3. Lane 1: NBR1 transfected lysate (107.4 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of NBR1 over-expressed 293 cell line, cotransfected with NBR1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with NBR1 monoclonal antibody (M05), clone 5C3 (Cat # orb2292629). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.19 KDa).