Cart summary

You have no items in your shopping cart.

    NARG1/NAA15 Antibody

    Catalog Number: orb389498

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb389498
    CategoryAntibodies
    DescriptionNARG1/NAA15 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsIHC, WB
    ReactivityHuman, Mouse
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human NARG1 (244-287aa ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY), different from the related mouse sequence by one amino acid.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Dilution rangeImmunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Human, By Heat Western blot, 0.1-0.5μg/ml, Human
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW101272 MW
    UniProt IDQ9BXJ9
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesN-alpha-acetyltransferase 15, NatA auxiliary subun
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    NARG1/NAA15 Antibody

    WB analysis of NARG1 using anti-NARG1 antibody.Lane 1:293T cell.

    NARG1/NAA15 Antibody

    IHC analysis of NARG1 using anti-NARG1 antibody. NARG1 was detected in paraffin-embedded section of mouse intestine tissues.

    • Anti-NARG1/NAA15 Antibody [orb1743941]

      ELISA,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      10 μg, 100 μg
    • NARG1 / NAA15 Antibody (aa221-270) [orb1539496]

      ELISA,  IHC,  IHC-P,  WB

      Human, Mouse

      Rabbit

      Polyclonal

      Unconjugated

      50 μl
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars