Naa60 Rabbit Polyclonal Antibody

SKU: orb325402

Description

Rabbit polyclonal antibody to Naa60

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Rat
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Naa60
• Target: Naa60
• Protein Sequence: Synthetic peptide located within the following region: IVGMIVAEIKNRTKIHKEDGDILASSFSVDTQVAYILSLGVVKEFRKHGI
• Molecular Weight: 26kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti MGC124897 antibody, anti RGD1308915 antibody

WB Suggested Anti-Naa60 Antibody, Titration: 1.0 ug/mL, Positive Control: Rat Heart.

Quick Database Links

Gene Symbol

Naa60

UniProt

Q3MHC1

RefSeq (Protein):NP_001014248