Naa60 Rabbit Polyclonal Antibody

• Catalog Number: orb325402
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Naa60
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Zebrafish
• Reactivity: Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Naa60
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 26kDa
• Target: Naa60
• UniProt ID: Q3MHC1
• Protein Sequence: Synthetic peptide located within the following region: IVGMIVAEIKNRTKIHKEDGDILASSFSVDTQVAYILSLGVVKEFRKHGI
• NCBI: NP_001014248
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MGC124897 antibody, anti RGD1308915 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Naa60 Antibody, Titration: 1.0 ug/mL, Positive Control: Rat Heart.