Myosin Phosphatase/PPP1R12A Antibody

• Catalog Number: orb316600
• Category: Antibodies
• Description: Myosin Phosphatase/PPP1R12A Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Gallus, Rabbit
• Reactivity: Human, Monkey, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PPP1R12A (1-40aa MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat, Monkey Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 115281 MW
• UniProt ID: O14974
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Protein phosphatase 1 regulatory subunit 12A;Myosi
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of HeLa cells using anti-PPP1R12A antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of U251 cells using anti-PPP1R12A antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of SiHa cells using anti-PPP1R12A antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of PPP1R12A using anti-PPP1R12A antibody.Lane 1:human HELA cell; 2:human Jurkat cell; 3:human HEK293 cell; 4:monkey COS-7 cell; 5:human Raji cell; 6:human K562 cell; 7:human CACO-2 cell; 8:human HEPG2 cell.

WB analysis of PPP1R12A using anti-PPP1R12A antibody.Lane 1:rat brain tissue; 2:rat lung tissue; 3:rat liver tissue; 4:rat C6 cell; 5:mouse brain tissue; 6:mouse lung tissue; 7:mouse liver tissue; 8:mouse NIH/3T3 cell.

IHC analysis of PPP1R12A using anti-PPP1R12A antibody. PPP1R12A was detected in paraffin-embedded section of Human Glioma Tissue.

IHC analysis of PPP1R12A using anti-PPP1R12A antibody.PPP1R12A was detected in immunocytochemical section of U251 cell.

IHC analysis of PPP1R12A using anti-PPP1R12A antibody.PPP1R12A was detected in immunocytochemical section of SiHa cell.

IHC analysis of PPP1R12A using anti-PPP1R12A antibody.PPP1R12A was detected in immunocytochemical section of U251 cell.

IHC analysis of PPP1R12A using anti-PPP1R12A antibody.PPP1R12A was detected in immunocytochemical section of U251 cell.

IHC analysis of PPP1R12A using anti-PPP1R12A antibody.PPP1R12A was detected in immunocytochemical section of U251 cell.