You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb865707 |
---|---|
Category | Antibodies |
Description | MYH6 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human MYH6 (RTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQ). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.25-0.5 μg/ml, Mouse Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Human, Mouse, Rat Flow Cytometry, 1-3 μg/1x106 cells, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 224 kDa |
UniProt ID | P13533 |
Storage | At -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing. |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of MYH6 using anti-MYH6 antibody (orb865707). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions. Lane 1: mouse heart tissue lysates. After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MYH6 antigen affinity purified polyclonal antibody (Catalog # orb865707) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # orb90503) with Tanon 5200 system. A specific band was detected for MYH6 at approximately 224 kDa. The expected band size for MYH6 is at 224 kDa.
IHC analysis of MYH6 using anti-MYH6 antibody (orb865707). MYH6 was detected in a paraffin-embedded section of human skeletal muscle tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-MYH6 Antibody (orb865707) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.
IHC analysis of MYH6 using anti-MYH6 antibody (orb865707). MYH6 was detected in a paraffin-embedded section of mouse cardiac tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-MYH6 Antibody (orb865707) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.
IHC analysis of MYH6 using anti-MYH6 antibody (orb865707). MYH6 was detected in a paraffin-embedded section of rat cardiac tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-MYH6 Antibody (orb865707) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.
Figure 5 Flow Cytometry analysis of U837 cells using anti-MYH6 antibody (orb865707). Overlay histogram showing U937 cells stained with orb865707 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-MYH6 Antibody (orb865707, 1 μg/1x10^6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10 μg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1 μg/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
ELISA, IHC-Fr, IHC-P | |
Bovine, Canine, Gallus, Human, Mouse, Porcine, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating