Myelin oligodendrocyte glycoprotein/MOG Antibody

• Catalog Number: orb526998
• Category: Antibodies
• Description: Myelin oligodendrocyte glycoprotein/MOG Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human Myelin oligodendrocyte glycoprotein/MOG (RVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGK).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 26 kDa
• UniProt ID: Q16653
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Myelin-oligodendrocyte glycoprotein; MOG
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of U251 cells using MOG antibody.

Immunohistochemical staining of Myelin oligodendrocyte glycoprotein using MOG antibody.

Immunohistochemical staining of Myelin oligodendrocyte glycoprotein using MOG antibody.

Immunohistochemical staining of Myelin oligodendrocyte glycoprotein using MOG antibody.

Immunohistochemical staining of Myelin oligodendrocyte glycoprotein using MOG antibody.

Western blot analysis of Myelin oligodendrocyte glycoprotein using MOG antibody