Musashi 1/Msi1 Antibody (monoclonal, 2B9)

• Catalog Number: orb623779
• Category: Antibodies
• Description: Musashi 1/Msi1 Antibody (monoclonal, 2B9)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2B9
• Tested applications: ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Mouse IgG2b
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Musashi 1/Msi1 (21-54aa KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 39 kDa
• UniProt ID: O43347
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Msi 1; Msi1 ; Musashi-1; Musashi1
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

IF analysis of MSI using anti-MSI antibody.

MSI was detected in paraffin-embedded section of human rectum cancer tissue.

IHC analysis of MSI using anti-MSI antibody.

WB analysis using anti-MSI antibody.Lane 1:A549 tissue, Lane 2:PC-3 cell.