You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2053357 |
---|---|
Category | Proteins |
Description | MUP6 Recombinant Protein (Mouse) |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 34.7 kDa |
UniProt ID | P02762 |
Protein Sequence | EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE |
Source | E.coli |
NCBI | NP_001128599 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | 100039247;Alpha-2U-globulin;Gm12552;Gm14076;Group Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
34.7 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
34.7 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
34.7 kDa | |
E.coli |
98.00% | |
36.6 kDa (predicted) |
Filter by Rating