Munc18-1/STXBP1 Antibody

• Catalog Number: orb334551
• Category: Antibodies
• Description: Munc18-1/STXBP1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Munc18-1 (184-216aa KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human Flow Cytometry, 1-3 μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 67569 MW
• UniProt ID: P61764
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Syntaxin-binding protein 1;MUNC18-1;N-Sec1;Protein
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A549 cells using anti-STXBP1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.

WB analysis of STXBP1 using anti-STXBP1 antibody.Lane 1:human HeLa cell; 2:rat brain tissue; 3:rat C6 cell; 4:mouse brain tissue.

IF analysis of STXBP1 using anti-STXBP1 antibody. STXBP1 was detected in an immunocytochemical section of HeLa cells.

IHC analysis of Munc18-1 using anti-Munc18-1 antibody. Munc18-1 was detected in a paraffin-embedded section of mouse brain tissue.

IHC analysis of Munc18-1 using anti-Munc18-1 antibody. Munc18-1 was detected in a paraffin-embedded section of rat brain tissue.

IHC analysis of Munc18-1 using anti-Munc18-1 antibody. Munc18-1 was detected in a paraffin-embedded section of human glioma tissue.