Muellerian-inhibiting factor/AMH Protein, Mouse, Recombinant (His)

• Catalog Number: orb1977133
• Category: Proteins
• Description: Muellerian-inhibiting factor/AMH Protein, Mouse, Recombinant (His) is expressed in Yeast.
• Tag: N-6xHis
• Purity: 98.00%
• MW: 13.3 kDa (predicted)
• UniProt ID: P27106
• Protein Sequence: DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC
• Expression System: P. pastoris (Yeast)
• Biological Origin: Mouse
• Biological Activity: Muellerian-inhibiting factor/AMH Protein, Mouse, Recombinant (His) is expressed in Yeast.
• Expression Region: 450-552 aa
• Storage: -20°C
• Note: For research use only
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expiration Date: 6 months from date of receipt.