You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb371689 |
---|---|
Category | Antibodies |
Description | MUC3/MUC3A/MUC3B Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human MUC3 (DLNDNTSQAYRDFNKTFWNQMQKIFADMQGFTFK). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 131402 MW |
UniProt ID | Q9H195 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Mucin-3B ;MUC-3B ;Intestinal mucin-3B ;MUC3B ; Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of MUC3 using anti-MUC3 antibody.Lane 1:human SW620 cell; 2:human COL320 cell; 3:human CACO-2 cell.
Filter by Rating