MUC2 Antibody

• Catalog Number: orb402450
• Category: Antibodies
• Description: MUC2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IHC
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human MUC2 (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, Mouse, Rat Immunofluorescence, 5μg/ml, Human, Mouse
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• UniProt ID: Q02817
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Mucin-2; MUC-2; Intestinal mucin-2; MUC2; SMUC
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

IF analysis of MUC2 using anti-MUC2 antibody.MUC2 was detected in paraffin-embedded section of human ileum tissue.

IF analysis of MUC2 using anti-MUC2 antibody.MUC2 was detected in paraffin-embedded section of human colon organoid tissue.

IF analysis of MUC2 using anti-MUC2 antibody.MUC2 was detected in paraffin-embedded section of mouse ileum tissue.

IF analysis of MUC2 using anti-MUC2 antibody.MUC2 was detected in paraffin-embedded section of mouse ileum organoid tissue.

IF analysis of MUC2 using anti-MUC2 antibody. MUC2 was detected in paraffin-embedded section of human intestine cancer tissue.

IF analysis of MUC2 using anti-MUC2 antibody. MUC2 was detected in paraffin-embedded section of mouse intestine tissue.

IHC analysis of MUC2 using anti-MUC2 antibody. MUC2 was detected in a paraffin-embedded section of human colon cancer tissue.

IHC analysis of MUC2 using anti-MUC2 antibody. MUC2 was detected in a paraffin-embedded section of mouse colon tissue.

IHC analysis of MUC2 using anti-MUC2 antibody. MUC2 was detected in a paraffin-embedded section of rat colon tissue.