You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb402450 |
---|---|
Category | Antibodies |
Description | MUC2 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IF, IHC |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human MUC2 (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, Mouse, Rat Immunofluorescence, 5μg/ml, Human, Mouse |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
UniProt ID | Q02817 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Mucin-2; MUC-2; Intestinal mucin-2; MUC2; SMUC Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
IF analysis of MUC2 using anti-MUC2 antibody.MUC2 was detected in paraffin-embedded section of human ileum tissue.
IF analysis of MUC2 using anti-MUC2 antibody.MUC2 was detected in paraffin-embedded section of human colon organoid tissue.
IF analysis of MUC2 using anti-MUC2 antibody.MUC2 was detected in paraffin-embedded section of mouse ileum tissue.
IF analysis of MUC2 using anti-MUC2 antibody.MUC2 was detected in paraffin-embedded section of mouse ileum organoid tissue.
IF analysis of MUC2 using anti-MUC2 antibody. MUC2 was detected in paraffin-embedded section of human intestine cancer tissue.
IF analysis of MUC2 using anti-MUC2 antibody. MUC2 was detected in paraffin-embedded section of mouse intestine tissue.
IHC analysis of MUC2 using anti-MUC2 antibody. MUC2 was detected in a paraffin-embedded section of human colon cancer tissue.
IHC analysis of MUC2 using anti-MUC2 antibody. MUC2 was detected in a paraffin-embedded section of mouse colon tissue.
IHC analysis of MUC2 using anti-MUC2 antibody. MUC2 was detected in a paraffin-embedded section of rat colon tissue.
ICC, IF, IHC-P | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating