You have no items in your shopping cart.
Cart summary
MT2731 Protein, Mycobacterium tuberculosis, Recombinant (His)
Catalog Number: orb1976919
| Catalog Number | orb1976919 |
|---|---|
| Category | Proteins |
| Description | Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the effect of cognate toxin MT2730. MT2731 Protein, Mycobacterium tuberculosis, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 9.7 kDa and the accession number is P9WJ10. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 9.7 kDa (predicted) |
| UniProt ID | P9WJ10 |
| Protein Sequence | MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDPP |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Mycobacterium tuberculosis |
| Biological Activity | Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the effect of cognate toxin MT2730. MT2731 Protein, Mycobacterium tuberculosis, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 9.7 kDa and the accession number is P9WJ10. |
| Expression Region | 1-81 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
