You have no items in your shopping cart.
Cart summary
MS4A1 Recombinant Protein (Mouse)
Catalog Number: orb2054048
| Catalog Number | orb2054048 |
|---|---|
| Category | Proteins |
| Description | MS4A1 Recombinant Protein (Mouse) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 34.1 kDa |
| UniProt ID | P19437 |
| Protein Sequence | ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP |
| Source | E.coli |
| NCBI | NP_031667 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | AA960661;B-cell differentiation antigen Ly-44;B-ly Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Mouse Ms4a1 protein [orb605351]
Greater than 90% as determined by SDS-PAGE.
20.1 kDa
Yeast
20 μg, 100 μg, 500 μg, 1 mgMouse Ms4a1 protein [orb604256]
Greater than 90% as determined by SDS-PAGE.
34.1 kDa
E.coli
20 μg, 100 μg, 1 mgMouse Ms4a1 protein [orb54101]
Greater than 90% as determined by SDS-PAGE.
22.3 kDa
Yeast
20 μg, 100 μg, 500 μg, 1 mgMS4A1 Recombinant Protein (Mouse) [orb2054047]
Greater than 90% as determined by SDS-PAGE.
34.1 kDa
E.coli
1 mgMS4A1 Recombinant Protein (Mouse) [orb2053566]
Greater than 90% as determined by SDS-PAGE.
22.3 kDa
Yeast
500 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
