MRP2/ABCC2 Antibody

• Catalog Number: orb546302
• Category: Antibodies
• Description: MRP2/ABCC2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Monkey, Mouse
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human MRP2/ABCC2 (AIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLD).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 190-250 kDa
• UniProt ID: Q92887
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Canalicular multispecific organic anion transporte
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of ABCC2 using anti-ABCC2 antibody.Lane 1:human Caco-2 cell.

IHC analysis of ABCC2 using anti-ABCC2 antibody.ABCC2 was detected in paraffin-embedded section of human liver cancer tissue.

IHC analysis of ABCC2 using anti-ABCC2 antibody.ABCC2 was detected in paraffin-embedded section of human lung cancer tissue.

IHC analysis of ABCC2 using anti-ABCC2 antibody.ABCC2 was detected in paraffin-embedded section of human mammary cancer tissue.

IHC analysis of ABCC2 using anti-ABCC2 antibody.ABCC2 was detected in paraffin-embedded section of human rectal cancer tissue.

IHC analysis of ABCC2 using anti-ABCC2 antibody.ABCC2 was detected in paraffin-embedded section of mouse kidney tissue.

IHC analysis of ABCC2 using anti-ABCC2 antibody.ABCC2 was detected in paraffin-embedded section of mouse liver tissue.