You have no items in your shopping cart.
Cart summary
MRP-126 Protein, Chicken, Recombinant (His)
Catalog Number: orb1979530
| Catalog Number | orb1979530 |
|---|---|
| Category | Proteins |
| Description | MRP-126 Protein, Chicken, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 15.6 kDa and the accession number is P28318. |
| Tag | C-6xHis |
| Purity | 98.00% |
| MW | 15.6 kDa (predicted) |
| UniProt ID | P28318 |
| Protein Sequence | MSKGCQTQGPLSELEKAIDVIIDVFHQYSRREGDKDTLTRKELKLLIEKQLANYLKHVKNQVSIDQIFKDLDNNKDQQLSFGEVMLLIIRVTVATHEHLHFCEDHQQQHQHQHQHQHNH |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Chicken |
| Biological Activity | MRP-126 Protein, Chicken, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 15.6 kDa and the accession number is P28318. |
| Expression Region | 1-119 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
