You have no items in your shopping cart.
Cart summary
MPT64 Protein, Mycobacterium tuberculosis, Recombinant (E. coli, His)
Catalog Number: orb1976905
| Catalog Number | orb1976905 |
|---|---|
| Category | Proteins |
| Description | MPT64 Protein, Mycobacterium tuberculosis, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 26.4 kDa and the accession number is P9WIN9. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 26.4 kDa (predicted) |
| UniProt ID | P9WIN9 |
| Protein Sequence | APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA |
| Expression System | E. coli |
| Biological Origin | Mycobacterium tuberculosis |
| Biological Activity | N/A. MPT64 Protein, Mycobacterium tuberculosis, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 26.4 kDa and the accession number is P9WIN9. |
| Expression Region | 24-228 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
