MPPED2 purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2295270
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human MPPED2 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Rat
• Immunogen: MPPED2 (NP_001575.1, 1 a.a. ~ 294 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS
• NCBI: NP_001575.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

MPPED2 MaxPab polyclonal antibody. Western Blot analysis of MPPED2 expression in rat brain.

Western Blot analysis of MPPED2 expression in transfected 293T cell line by MPPED2 MaxPab polyclonal antibody. Lane 1: MPPED2 transfected lysate(32.34 KDa). Lane 2: Non-transfected lysate.