MPPED2 monoclonal antibody (M01A), clone 2G1-1B7

• Catalog Number: orb2295268
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant MPPED2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2G1-1B7
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgM kappa
• Immunogen: MPPED2 (AAH31582, 1 a.a. ~ 294 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS
• NCBI: AAH31582
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of MPPED2 expression in transfected 293T cell line by C11orf8 monoclonal antibody (M01A), clone 2G1-1B7. Lane 1: MPPED2 transfected lysate(33.81 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (58.08 KDa).