MPPED2 monoclonal antibody (M08), clone 4H5

• Catalog Number: orb2295267
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant MPPED2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4H5
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: MPPED2 (AAH31582, 1 a.a. ~ 294 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS
• NCBI: AAH31582
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

MPPED2 monoclonal antibody (M08), clone 4H5. Western Blot analysis of MPPED2 expression in IMR-32.

Western Blot analysis of MPPED2 expression in transfected 293T cell line by MPPED2 monoclonal antibody (M08), clone 4H5. Lane 1: MPPED2 transfected lysate(33.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (58.08 KDa).