MPHOSPH9 monoclonal antibody (M10), clone 4E10

• Catalog Number: orb2291608
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant MPHOSPH9.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4E10
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: MPHOSPH9 (NP_073619, 922 a.a. ~ 1031 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SVRTAWEKNKSVSYEQCKPVSVTPQGNDFEYTAKIRTLAETERFFDELTKEKDQIEAALSRMPSPGGRITLQTRLNQEALEDRLERINRELGSVRMTLKKFHVLRTSANL
• NCBI: NP_073619
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged MPHOSPH9 is approximately 1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to MPHOSPH9 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (37.84 KDa).