Monoamine Oxidase B/MAOB Antibody

• Catalog Number: orb315173
• Category: Antibodies
• Description: Monoamine Oxidase B/MAOB Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MAOB (448-484aa REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 58763 MW
• UniProt ID: P27338
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Amine oxidase [flavin-containing] B;1.4.3.4;Monoam
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of MAOB using anti-MAOB antibody.Lane 1:Rat Cardiac MuscleTissue;2:Rat Kidney Tissue;3:Rat Intestine Tissue;4:Mouse Kidney Tissue;5:Mouse Intestine Tissue;6:Mouse Cardiac Muscle Tissue;7:HEPG2 Cell;8:HELA Cell;9:COLO320 Cell.

WB analysis of MAOB using anti-MAOB antibody.Lane 1:Rat Brain Tissue;2:Mouse Brain Tissue.

IHC analysis of MAOB using anti-MAOB antibody. MAOB was detected in a paraffin-embedded section of mouse intestine tissue.

IHC analysis of MAOB using anti-MAOB antibody. MAOB was detected in a paraffin-embedded section of rat intestine tissue.

IHC analysis of MAOB using anti-MAOB antibody. MAOB was detected in a paraffin-embedded section of human lung cancer tissue.